Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01012643001
Common NameLOC100264009, VIT_10s0116g00680
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family HD-ZIP
Protein Properties Length: 727aa    MW: 79665.4 Da    PI: 6.2904
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01012643001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
           Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
                        688999***********************************************998 PP

              START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                        ela +a++el+++a+a+ep+W   s    e++ +de+l++f+++ +      ++ea+r+++vv+m++  lve+l+d++ qW+  +     +a
                        57899*****************9999999**************999********************************.************* PP

              START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskv 164
                        +tlev+s+g      galq+m+ae+q++splvp R+ +fvRy++ +++g+w++vdvS+d+ ++ p    + R +++pSg+li++++ng+skv
                        ****************************************************************9....6********************** PP

              START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                        +wvehv++++r +h+++r+lv+sgla+gak+wvatl+rqce+
                        ****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.89255115IPR001356Homeobox domain
SMARTSM003891.0E-1956119IPR001356Homeobox domain
PfamPF000463.5E-1858113IPR001356Homeobox domain
CDDcd000863.50E-1958116No hitNo description
PROSITE patternPS00027090113IPR017970Homeobox, conserved site
SuperFamilySSF559617.56E-38238469No hitNo description
PROSITE profilePS5084846.73238470IPR002913START domain
CDDcd088754.05E-128242466No hitNo description
SMARTSM002341.4E-70247467IPR002913START domain
PfamPF018522.4E-56248467IPR002913START domain
Gene3DG3DSA:3.30.530.207.2E-7344467IPR023393START-like domain
SuperFamilySSF559618.24E-25487718No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009913Biological Processepidermal cell differentiation
GO:0048497Biological Processmaintenance of floral organ identity
GO:0048825Biological Processcotyledon development
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 727 aa     Download sequence    Send to blast
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.194420.0bud| inflorescence
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4839510.0AM483951.2 Vitis vinifera contig VV78X162089.20, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002266688.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLE0CVM00.0E0CVM0_VITVI; Putative uncharacterized protein
STRINGVIT_10s0116g00680.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2